Lineage for d1r4ya_ (1r4y A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 405195Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 405196Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 405347Family d.1.1.3: Ribotoxin [81310] (2 proteins)
    the fungal cytotoxic ribonucleases with many insertions in the common fold
  6. 405348Protein alpha-Sarcin [81309] (1 species)
  7. 405349Species Fungus (Aspergillus giganteus) [TaxId:5060] [53953] (2 PDB entries)
  8. 405351Domain d1r4ya_: 1r4y A: [97056]
    delta(7-22) mutant

Details for d1r4ya_

PDB Entry: 1r4y (more details)

PDB Description: solution structure of the deletion mutant delta(7-22) of the cytotoxic ribonuclease alpha-sarcin

SCOP Domain Sequences for d1r4ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4ya_ d.1.1.3 (A:) alpha-Sarcin {Fungus (Aspergillus giganteus)}
avtwtcggllynqnkaesnshhaplsdgktgssyphwftngydgdgklpkgrtpikfgks
dcdrppkhskdgngktdhyllefptfpdghdykfdskkpkenpgparviytypnkvfcgi
iahtkenqgelklcsh

SCOP Domain Coordinates for d1r4ya_:

Click to download the PDB-style file with coordinates for d1r4ya_.
(The format of our PDB-style files is described here.)

Timeline for d1r4ya_: