![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
![]() | Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) ![]() |
![]() | Family d.1.1.3: Ribotoxin [81310] (2 proteins) the fungal cytotoxic ribonucleases with many insertions in the common fold |
![]() | Protein alpha-Sarcin [81309] (1 species) |
![]() | Species Fungus (Aspergillus giganteus) [TaxId:5060] [53953] (2 PDB entries) |
![]() | Domain d1r4ya_: 1r4y A: [97056] delta(7-22) mutant |
PDB Entry: 1r4y (more details)
SCOP Domain Sequences for d1r4ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r4ya_ d.1.1.3 (A:) alpha-Sarcin {Fungus (Aspergillus giganteus)} avtwtcggllynqnkaesnshhaplsdgktgssyphwftngydgdgklpkgrtpikfgks dcdrppkhskdgngktdhyllefptfpdghdykfdskkpkenpgparviytypnkvfcgi iahtkenqgelklcsh
Timeline for d1r4ya_: