Lineage for d1r4pb_ (1r4p B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 373966Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 373967Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 374244Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 374363Species Shigella dysenteriae, toxin II [TaxId:622] [101755] (1 PDB entry)
  8. 374364Domain d1r4pb_: 1r4p B: [97026]
    Other proteins in same PDB: d1r4pa_

Details for d1r4pb_

PDB Entry: 1r4p (more details), 1.77 Å

PDB Description: shiga toxin type 2

SCOP Domain Sequences for d1r4pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4pb_ b.40.2.1 (B:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin II}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
gfaevqfnnd

SCOP Domain Coordinates for d1r4pb_:

Click to download the PDB-style file with coordinates for d1r4pb_.
(The format of our PDB-style files is described here.)

Timeline for d1r4pb_: