![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) ![]() |
![]() | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) |
![]() | Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species) phage-borne toxin; bacteriophages H30 and H19B |
![]() | Species Shigella dysenteriae, toxin II [TaxId:622] [101755] (1 PDB entry) |
![]() | Domain d1r4pc_: 1r4p C: [97027] Other proteins in same PDB: d1r4pa_ |
PDB Entry: 1r4p (more details), 1.77 Å
SCOP Domain Sequences for d1r4pc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r4pc_ b.40.2.1 (C:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin II} adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs gfaevqfnnd
Timeline for d1r4pc_: