Lineage for d1q9wd1 (1q9w D:1-111)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510705Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (57 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 1510720Domain d1q9wd1: 1q9w D:1-111 [96326]
    Other proteins in same PDB: d1q9wa1, d1q9wa2, d1q9wb2, d1q9wc1, d1q9wc2, d1q9wd2
    part of Fab s45-18
    complexed with mg

Details for d1q9wd1

PDB Entry: 1q9w (more details), 1.75 Å

PDB Description: s45-18 fab pentasaccharide bisphosphate complex
PDB Compounds: (D:) S45-18 Fab (IgG1k) heavy chain

SCOPe Domain Sequences for d1q9wd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9wd1 b.1.1.1 (D:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evilvesggglvqpggslrlscstsgftftdyymswvrqppgkalewlgfirnkpkgytt
eysasvkgrftisrdnsqsilylqmntlraedsatyycvrdiysfgsrdgmdywgqgtsv
tvss

SCOPe Domain Coordinates for d1q9wd1:

Click to download the PDB-style file with coordinates for d1q9wd1.
(The format of our PDB-style files is described here.)

Timeline for d1q9wd1: