SCOPe 2.04: Domain d1q9wa1: 1q9w A:1-107

Lineage for d1q9wa1 (1q9w A:1-107)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (46 PDB entries)

8. Domain d1q9wa1: 1q9w A:1-107 [96320]
   Other proteins in same PDB: d1q9wa2, d1q9wb1, d1q9wb2, d1q9wc2, d1q9wd1, d1q9wd2
   part of Fab s45-18
   complexed with mg

Details for d1q9wa1

PDB Entry: 1q9w, 1.75 Å

PDB Description: s45-18 fab pentasaccharide bisphosphate complex

PDB Compounds: (A:) S45-18 Fab (IgG1k) light chain

SCOPe Domain Sequences for d1q9wa1:

Sequence; same for both SEQRES and ATOM records:

>d1q9wa1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqfpsslavsagekvtmsckssqsllnsrtrksylawyqqkpgqfpklliywaatr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlrtfgggtkleikr

Timeline for d1q9wa1:

• d1q9wa1 first appeared in SCOP 1.67
  
• d1q9wa1 appears in SCOPe 2.03
  
• d1q9wa1 appears in SCOPe 2.05
  
• d1q9wa1 appears in the current release, SCOPe 2.08