Class a: All alpha proteins [46456] (284 folds) |
Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily) multihelical; 8 helices arranged in 2 parallel layers |
Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site |
Family a.129.1.2: Group II chaperonin (CCT, TRIC), ATPase domain [48596] (1 protein) |
Protein Thermosome, E domain [48597] (3 species) |
Species Thermococcus sp. ks-1, alpha chain [TaxId:79679] [101457] (4 PDB entries) |
Domain d1q3qb1: 1q3q B:9-145,B:406-526 [95707] Other proteins in same PDB: d1q3qa2, d1q3qa3, d1q3qb2, d1q3qb3, d1q3qc2, d1q3qc3, d1q3qd2, d1q3qd3 complexed with anp, mg; mutant |
PDB Entry: 1q3q (more details), 2.3 Å
SCOPe Domain Sequences for d1q3qb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q3qb1 a.129.1.2 (B:9-145,B:406-526) Thermosome, E domain {Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcati ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy alaaekaqeildeiairXavlpaggapeielairldeyakqvggkealaienfadalkii pktlaenagldtvemlvkvisehknrglgigidvfegkpadmlekgiieplrvkkqaiks aseaaimilriddviaaka
Timeline for d1q3qb1: