Lineage for d1q3qd3 (1q3q D:146-216,D:370-405)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203618Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 1203619Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 1203775Family d.56.1.2: Group II chaperonin (CCT, TRIC), intermediate domain [54853] (1 protein)
  6. 1203776Protein Thermosome, I domain [54854] (3 species)
  7. 1203777Species Thermococcus sp. ks-1, alpha chain [TaxId:79679] [102951] (4 PDB entries)
  8. 1203781Domain d1q3qd3: 1q3q D:146-216,D:370-405 [95715]
    Other proteins in same PDB: d1q3qa1, d1q3qa2, d1q3qb1, d1q3qb2, d1q3qc1, d1q3qc2, d1q3qd1, d1q3qd2
    complexed with anp, mg; mutant

Details for d1q3qd3

PDB Entry: 1q3q (more details), 2.3 Å

PDB Description: crystal structure of the chaperonin from thermococcus strain ks-1 (two-point mutant complexed with amp-pnp)
PDB Compounds: (D:) Thermosome alpha subunit

SCOPe Domain Sequences for d1q3qd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3qd3 d.56.1.2 (D:146-216,D:370-405) Thermosome, I domain {Thermococcus sp. ks-1, alpha chain [TaxId: 79679]}
vdpddeetllkiaatsitgknaeshkellaklaveavkqvaekkdgkyvvdldnikfekk
agegveeselvXkavtilirggtehvideveraledavkvvkdvmedg

SCOPe Domain Coordinates for d1q3qd3:

Click to download the PDB-style file with coordinates for d1q3qd3.
(The format of our PDB-style files is described here.)

Timeline for d1q3qd3: