SCOPe 2.01: Domain d1q2vc3: 1q2v C:146-216,C:370-405

Lineage for d1q2vc3 (1q2v C:146-216,C:370-405)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
   3-helical bundle packed against 3-stranded mixed beta-sheet

4. Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families)

5. Family d.56.1.2: Group II chaperonin (CCT, TRIC), intermediate domain [54853] (1 protein)

6. Protein Thermosome, I domain [54854] (3 species)

7. Species Thermococcus sp. ks-1, alpha chain [TaxId:79679] [102951] (4 PDB entries)

8. Domain d1q2vc3: 1q2v C:146-216,C:370-405 [95651]
   Other proteins in same PDB: d1q2va1, d1q2va2, d1q2vb1, d1q2vb2, d1q2vc1, d1q2vc2, d1q2vd1, d1q2vd2
   complexed with so4

Details for d1q2vc3

PDB Entry: 1q2v, 2.4 Å

PDB Description: crystal structure of the chaperonin from thermococcus strain ks-1 (nucleotide-free form)

PDB Compounds: (C:) Thermosome alpha subunit

SCOPe Domain Sequences for d1q2vc3:

Sequence; same for both SEQRES and ATOM records:

>d1q2vc3 d.56.1.2 (C:146-216,C:370-405) Thermosome, I domain {Thermococcus sp. ks-1, alpha chain [TaxId: 79679]}
vdpddeetllkiaatsitgknaeshkellaklaveavkqvaekkdgkyvvdldnikfekk
agegveeselvXkavtilirggtehvideveraledavkvvkdvmedg

Timeline for d1q2vc3:

• d1q2vc3 first appeared in SCOP 1.67
  
• d1q2vc3 appears in SCOP 1.75
  
• d1q2vc3 appears in SCOPe 2.02
  
• d1q2vc3 appears in the current release, SCOPe 2.08