Lineage for d1q2vb2 (1q2v B:217-369)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 979734Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 979893Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 980064Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein)
  6. 980065Protein Thermosome, A-domain [52035] (4 species)
  7. 980079Species Thermococcus sp. ks-1, alpha chain [TaxId:79679] [102202] (4 PDB entries)
  8. 980085Domain d1q2vb2: 1q2v B:217-369 [95647]
    Other proteins in same PDB: d1q2va1, d1q2va3, d1q2vb1, d1q2vb3, d1q2vc1, d1q2vc3, d1q2vd1, d1q2vd3
    complexed with so4

Details for d1q2vb2

PDB Entry: 1q2v (more details), 2.4 Å

PDB Description: crystal structure of the chaperonin from thermococcus strain ks-1 (nucleotide-free form)
PDB Compounds: (B:) Thermosome alpha subunit

SCOPe Domain Sequences for d1q2vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q2vb2 c.8.5.2 (B:217-369) Thermosome, A-domain {Thermococcus sp. ks-1, alpha chain [TaxId: 79679]}
rgvvidkevvhprmpkrvenakialinealevkktetdakinitspdqlmsfleqeekml
kdmvdhiaqtganvvfvqkgiddlaqhylakygimavrrvkksdmeklakatgakivtnv
kdltpedlgyaevveerklagenmifvegcknp

SCOPe Domain Coordinates for d1q2vb2:

Click to download the PDB-style file with coordinates for d1q2vb2.
(The format of our PDB-style files is described here.)

Timeline for d1q2vb2: