Lineage for d1q1jm2 (1q1j M:109-213)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2028905Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2028909Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)
  8. 2028947Domain d1q1jm2: 1q1j M:109-213 [95588]
    Other proteins in same PDB: d1q1jh1, d1q1jh2, d1q1ji1, d1q1ji2, d1q1jl1, d1q1jm1
    part of anti HIV-1 Fab 447-52d

Details for d1q1jm2

PDB Entry: 1q1j (more details), 2.5 Å

PDB Description: Crystal Structure Analysis of anti-HIV-1 Fab 447-52D in complex with V3 peptide
PDB Compounds: (M:) Fab 447-52D, light chain

SCOPe Domain Sequences for d1q1jm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1jm2 b.1.1.2 (M:109-213) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
pkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqs
nnkyaassylsltpeqwkshrsyscqvthegstvektvapte

SCOPe Domain Coordinates for d1q1jm2:

Click to download the PDB-style file with coordinates for d1q1jm2.
(The format of our PDB-style files is described here.)

Timeline for d1q1jm2: