Lineage for d1pzfa1 (1pzf A:14-163)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1153084Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 1153123Protein Lactate dehydrogenase [51859] (14 species)
  7. 1153207Species Toxoplasma gondii [TaxId:5811] [102166] (4 PDB entries)
  8. 1153217Domain d1pzfa1: 1pzf A:14-163 [95417]
    Other proteins in same PDB: d1pzfa2, d1pzfb2, d1pzfc2, d1pzfd2
    complexed with a3d, oxl

Details for d1pzfa1

PDB Entry: 1pzf (more details), 2.2 Å

PDB Description: T.gondii LDH1 ternary complex with APAD+ and oxalate
PDB Compounds: (A:) lactate dehydrogenase

SCOPe Domain Sequences for d1pzfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzfa1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
cpktfiivvtnpldcmvkvmceasgvptnmicgm

SCOPe Domain Coordinates for d1pzfa1:

Click to download the PDB-style file with coordinates for d1pzfa1.
(The format of our PDB-style files is described here.)

Timeline for d1pzfa1: