Lineage for d1pywa2 (1pyw A:4-81)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897796Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1897835Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries)
  8. 1897839Domain d1pywa2: 1pyw A:4-81 [95378]
    Other proteins in same PDB: d1pywa1, d1pywb1, d1pywb2, d1pywd1, d1pywd2

Details for d1pywa2

PDB Entry: 1pyw (more details), 2.1 Å

PDB Description: human class ii mhc protein hla-dr1 bound to a designed peptide related to influenza virus hemagglutinin, fvkqna(maa)al, in complex with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1pywa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pywa2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOPe Domain Coordinates for d1pywa2:

Click to download the PDB-style file with coordinates for d1pywa2.
(The format of our PDB-style files is described here.)

Timeline for d1pywa2: