SCOPe 2.05: Domain d1pywd2: 1pyw D:122-239

Lineage for d1pywd2 (1pyw D:122-239)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries)
   Uniprot P23313

8. Domain d1pywd2: 1pyw D:122-239 [95382]
   Other proteins in same PDB: d1pywa1, d1pywa2, d1pywb1, d1pywb2, d1pywd1

Details for d1pywd2

PDB Entry: 1pyw, 2.1 Å

PDB Description: human class ii mhc protein hla-dr1 bound to a designed peptide related to influenza virus hemagglutinin, fvkqna(maa)al, in complex with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)

PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d1pywd2:

Sequence; same for both SEQRES and ATOM records:

>d1pywd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

Timeline for d1pywd2:

• d1pywd2 first appeared in SCOP 1.67
  
• d1pywd2 appears in SCOPe 2.04
  
• d1pywd2 appears in SCOPe 2.06
  
• d1pywd2 appears in the current release, SCOPe 2.08