SCOPe 2.02: Domain d1pwwb3: 1pww B:264-550

Lineage for d1pwwb3 (1pww B:264-550)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein Anthrax toxin lethal factor, middle domain [69845] (1 species)
   includes an all-alpha insert subdomain

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69846] (9 PDB entries)

8. Domain d1pwwb3: 1pww B:264-550 [95261]
   Other proteins in same PDB: d1pwwa1, d1pwwa2, d1pwwb1, d1pwwb2
   complexed with an optimized peptide substrate (chains C and D) in the presence of zinc
   complexed with zn; mutant

Details for d1pwwb3

PDB Entry: 1pww, 2.8 Å

PDB Description: crystal structure of anthrax lethal factor active site mutant protein complexed with an optimised peptide substrate in the presence of zinc.

PDB Compounds: (B:) Lethal Factor

SCOPe Domain Sequences for d1pwwb3:

Sequence, based on SEQRES records:

>d1pwwb3 d.166.1.1 (B:264-550) Anthrax toxin lethal factor, middle domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mlsryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriq
idssdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflkklkldi
qpydinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiylyenmni
nnltatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldnerlkwri
qlspdtragylengklilqrnigleikdvqiikqsekeyiridakvv

Sequence, based on observed residues (ATOM records):

>d1pwwb3 d.166.1.1 (B:264-550) Anthrax toxin lethal factor, middle domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mlsryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriq
idssdflsteekeflkklqidirdslsnplsekekeflkklkldiqpydinqrlqdtggl
idspsinldvrkqykrdiqnidallhqsigstlynkiylyenmninnltatlgadlvdst
dntkinrgifnefkknfkysissnymivdinerpaldnerlkwriqlspdtragylengk
lilqrnigleikdvqiikqsekeyiridakvv

Timeline for d1pwwb3:

• d1pwwb3 first appeared in SCOP 1.67
  
• d1pwwb3 appears in SCOPe 2.01
  
• d1pwwb3 appears in SCOPe 2.03
  
• d1pwwb3 appears in the current release, SCOPe 2.08