SCOPe 2.02: Domain d1pwvb1: 1pwv B:33-263

Lineage for d1pwvb1 (1pwv B:33-263)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (1 protein)

6. Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
   duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69777] (9 PDB entries)

8. Domain d1pwvb1: 1pwv B:33-263 [95253]
   Other proteins in same PDB: d1pwva3, d1pwvb3
   complexed with an optimized peptide substrate (chains C and D) in the presence of zinc

Details for d1pwvb1

PDB Entry: 1pwv, 2.85 Å

PDB Description: Crystal structure of Anthrax Lethal Factor wild-type protein complexed with an optimised peptide substrate.

PDB Compounds: (B:) Lethal Factor

SCOPe Domain Sequences for d1pwvb1:

Sequence; same for both SEQRES and ATOM records:

>d1pwvb1 d.92.1.14 (B:33-263) Anthrax toxin lethal factor, N- and C-terminal domains {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
eehlkeimkhivkievkgeeavkkeaaekllekvpsdvlemykaiggkiyivdgditkhi
slealsedkkkikdiygkdallhehyvyakegyepvlviqssedyventekalnvyyeig
kilsrdilskinqpyqkfldvlntiknasdsdgqdllftnqlkehptdfsvefleqnsne
vqevfakafayyiepqhrdvlqlyapeafnymdkfneqeinlsleelkdqr

Timeline for d1pwvb1:

• d1pwvb1 first appeared in SCOP 1.67
  
• d1pwvb1 appears in SCOPe 2.01
  
• d1pwvb1 appears in SCOPe 2.03
  
• d1pwvb1 appears in the current release, SCOPe 2.08