Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (1 protein) |
Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species) duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69777] (9 PDB entries) |
Domain d1pwva1: 1pwv A:27-263 [95250] Other proteins in same PDB: d1pwva3, d1pwvb3 complexed with an optimized peptide substrate (chains C and D) in the presence of zinc |
PDB Entry: 1pwv (more details), 2.85 Å
SCOPe Domain Sequences for d1pwva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pwva1 d.92.1.14 (A:27-263) Anthrax toxin lethal factor, N- and C-terminal domains {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} ernktqeehlkeimkhivkievkgeeavkkeaaekllekvpsdvlemykaiggkiyivdg ditkhislealsedkkkikdiygkdallhehyvyakegyepvlviqssedyventekaln vyyeigkilsrdilskinqpyqkfldvlntiknasdsdgqdllftnqlkehptdfsvefl eqnsnevqevfakafayyiepqhrdvlqlyapeafnymdkfneqeinlsleelkdqr
Timeline for d1pwva1: