SCOPe 2.05: Domain d1pfwa3: 1pfw A:141-175

Lineage for d1pfwa3 (1pfw A:141-175)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.1: Methionyl-tRNA synthetase (MetRS), Zn-domain [57770] (1 family)

5. Family g.41.1.1: Methionyl-tRNA synthetase (MetRS), Zn-domain [57771] (1 protein)
   in the Pyrococcus abyssi MetRS structure there is a tandem repeat of two such domains swapped with their zinc-binding 'knuckles', this duplicated finger occupies a larger region (124-183) than defined below; there is a structurally equivalent region in the E. coli enzyme lacking the second zinc-binding site

6. Protein Methionyl-tRNA synthetase (MetRS), Zn-domain [57772] (2 species)

7. Species Escherichia coli [TaxId:562] [57773] (9 PDB entries)

8. Domain d1pfwa3: 1pfw A:141-175 [94665]
   Other proteins in same PDB: d1pfwa1, d1pfwa2
   protein/RNA complex; complexed with mf3, zn

Details for d1pfwa3

PDB Entry: 1pfw, 1.78 Å

PDB Description: methionyl-trna synthetase from escherichia coli complexed with trifluoromethionine

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1pfwa3:

Sequence; same for both SEQRES and ATOM records:

>d1pfwa3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli [TaxId: 562]}
vkgtcpkckspdqygdncevcgatyspteliepks

Timeline for d1pfwa3:

• d1pfwa3 first appeared in SCOP 1.67
  
• d1pfwa3 appears in SCOPe 2.04
  
• d1pfwa3 appears in SCOPe 2.06
  
• d1pfwa3 appears in the current release, SCOPe 2.08