SCOPe 2.02: Domain d1p3lg_: 1p3l G:

Lineage for d1p3lg_ (1p3l G:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2A [47115] (6 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (33 PDB entries)

8. Domain d1p3lg_: 1p3l G: [94038]
   Other proteins in same PDB: d1p3la_, d1p3lb_, d1p3ld_, d1p3le_, d1p3lf_, d1p3lh_
   protein/DNA complex; mutant

Details for d1p3lg_

PDB Entry: 1p3l, 2.4 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

PDB Compounds: (G:) histone h2a

SCOPe Domain Sequences for d1p3lg_:

Sequence; same for both SEQRES and ATOM records:

>d1p3lg_ a.22.1.1 (G:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaa
rdnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk

Timeline for d1p3lg_:

• d1p3lg_ first appeared in SCOP 1.67
  
• d1p3lg_ appears in SCOPe 2.01
  
• d1p3lg_ appears in SCOPe 2.03
  
• d1p3lg_ appears in the current release, SCOPe 2.08