Lineage for d1p1zd_ (1p1z D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001624Protein NK cell receptor [56452] (3 species)
  7. Species Mouse (Mus musculus), ly49-c [TaxId:10090] [103351] (2 PDB entries)
  8. 3001630Domain d1p1zd_: 1p1z D: [93906]
    Other proteins in same PDB: d1p1za1, d1p1za2, d1p1zb_

Details for d1p1zd_

PDB Entry: 1p1z (more details), 3.26 Å

PDB Description: x-ray crystal structure of the lectin-like natural killer cell receptor ly-49c bound to its mhc class i ligand h-2kb
PDB Compounds: (D:) LY49-C antigen

SCOPe Domain Sequences for d1p1zd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1zd_ d.169.1.1 (D:) NK cell receptor {Mouse (Mus musculus), ly49-c [TaxId: 10090]}
vywfcystkcyyfimnkttwsgckancqhysvpilkiededelkflqrhvipenywigls
ydkkkkewawidngpskldmkirkmnfksrgcvflskariedidcnipyycicgkkld

SCOPe Domain Coordinates for d1p1zd_:

Click to download the PDB-style file with coordinates for d1p1zd_.
(The format of our PDB-style files is described here.)

Timeline for d1p1zd_: