Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins) |
Protein Ribonuclease PH, domain 1 [102758] (4 species) |
Species Bacillus subtilis [TaxId:1423] [102761] (3 PDB entries) |
Domain d1oype1: 1oyp E:1-151 [93742] Other proteins in same PDB: d1oypa2, d1oypb2, d1oypc2, d1oypd2, d1oype2, d1oypf2 complexed with so4 |
PDB Entry: 1oyp (more details), 2.76 Å
SCOPe Domain Sequences for d1oype1:
Sequence, based on SEQRES records: (download)
>d1oype1 d.14.1.4 (E:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]} mrhdgrqhdelrpitfdldfishpegsvlitagntkvicnasvedrvppflrgggkgwit aeysmlpratnqrtiresskgkisgrtmeiqrligralravvdleklgertiwidcdviq adggtrtasitgaflamaiaigklikagtik
>d1oype1 d.14.1.4 (E:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]} mrhdgrqhdelrpitfdldfishpegsvlitagntkvicnasvedrvppflrgggkgwit aeysmlsgrtmeiqrligralravvdleklgertiwidcdviqadggtrtasitgaflam aiaigklikagtik
Timeline for d1oype1: