Lineage for d1otka1 (1otk A:3-244)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703456Protein Phenylacetic acid degradation protein PaaC [101136] (1 species)
  7. 2703457Species Escherichia coli [TaxId:562] [101137] (1 PDB entry)
  8. 2703458Domain d1otka1: 1otk A:3-244 [93521]
    Other proteins in same PDB: d1otka2, d1otkb2
    structural genomics

Details for d1otka1

PDB Entry: 1otk (more details), 2 Å

PDB Description: structural genomics, protein paac
PDB Compounds: (A:) Phenylacetic acid degradation protein paaC

SCOPe Domain Sequences for d1otka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otka1 a.25.1.2 (A:3-244) Phenylacetic acid degradation protein PaaC {Escherichia coli [TaxId: 562]}
nqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaelag
egdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqlaa
isakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidialse
egiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqylqr
vl

SCOPe Domain Coordinates for d1otka1:

Click to download the PDB-style file with coordinates for d1otka1.
(The format of our PDB-style files is described here.)

Timeline for d1otka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1otka2