SCOP 1.67: Domain d1otka_: 1otk A:

Lineage for d1otka_ (1otk A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (3 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins)

6. Protein Phenylacetic acid degradation protein PaaC [101136] (1 species)

7. Species Escherichia coli [TaxId:562] [101137] (1 PDB entry)

8. Domain d1otka_: 1otk A: [93521]

Details for d1otka_

PDB Entry: 1otk, 2 Å

PDB Description: structural genomics, protein paac

SCOP Domain Sequences for d1otka_:

Sequence; same for both SEQRES and ATOM records:

>d1otka_ a.25.1.2 (A:) Phenylacetic acid degradation protein PaaC {Escherichia coli}
hgnqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaael
agegdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpql
aaisakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidial
seegiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqyl
qrvl

Timeline for d1otka_:

• d1otka_ is new in SCOP 1.67
  
• d1otka_ appears in SCOP 1.69
  
• d1otka_ appears in the current release, SCOPe 2.08, called d1otka1