Lineage for d1o7bt_ (1o7b T:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1226319Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1226320Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1226787Family d.169.1.4: Link domain [56477] (3 proteins)
  6. 1226794Protein TSG-6, Link module [56478] (1 species)
  7. 1226795Species Human (Homo sapiens) [TaxId:9606] [56479] (3 PDB entries)
  8. 1226801Domain d1o7bt_: 1o7b T: [92620]

Details for d1o7bt_

PDB Entry: 1o7b (more details)

PDB Description: refined solution structure of the human tsg-6 link module
PDB Compounds: (T:) tumor necrosis factor-inducible protein tsg-6

SCOPe Domain Sequences for d1o7bt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7bt_ d.169.1.4 (T:) TSG-6, Link module {Human (Homo sapiens) [TaxId: 9606]}
gvyhrearsgkykltyaeakavcefegghlatykqleaarkigfhvcaagwmakgrvgyp
ivkpgpncgfgktgiidygirlnrserwdaycynphak

SCOPe Domain Coordinates for d1o7bt_:

Click to download the PDB-style file with coordinates for d1o7bt_.
(The format of our PDB-style files is described here.)

Timeline for d1o7bt_: