PDB entry 1o7b

View 1o7b on RCSB PDB site
Description: refined solution structure of the human tsg-6 link module
Class: cell adhesion
Keywords: hyaluronan-binding domain, carbohydrate-binding domain, link module, cell adhesion, glycoprotein
Deposited on 2002-10-29, released 2003-10-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'T':
    Compound: tumor necrosis factor-inducible protein tsg-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1o7bt_

PDB Chain Sequences:

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o7bT (T:)
    gvyhrearsgkykltyaeakavcefegghlatykqleaarkigfhvcaagwmakgrvgyp
    ivkpgpncgfgktgiidygirlnrserwdaycynphak