Lineage for d1ntoh2 (1nto H:144-313)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826590Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
    N-terminal all-beta domain defines family
  6. 1826611Protein Alcohol dehydrogenase [51737] (9 species)
  7. 1826787Species Sulfolobus solfataricus [TaxId:2287] [82286] (4 PDB entries)
  8. 1826794Domain d1ntoh2: 1nto H:144-313 [92148]
    Other proteins in same PDB: d1ntoa1, d1ntob1, d1ntoc1, d1ntod1, d1ntoe1, d1ntoh1
    complexed with zn; mutant

Details for d1ntoh2

PDB Entry: 1nto (more details), 1.94 Å

PDB Description: n249y mutant of alcohol dehydrogenase from the archaeon sulfolobus solfataricus-monoclinic crystal form
PDB Compounds: (H:) NAD-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1ntoh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntoh2 c.2.1.1 (H:144-313) Alcohol dehydrogenase {Sulfolobus solfataricus [TaxId: 2287]}
lnaveaapltcsgittyravrkasldptktllvvgaggglgtmavqiakavsgatiigvd
vreeaveaakragadyvinasmqdplaeirriteskgvdavidlnysektlsvypkalak
qgkyvmvglfgadlhyhaplitlseiqfvgslvgnqsdflgimrlaeagk

SCOPe Domain Coordinates for d1ntoh2:

Click to download the PDB-style file with coordinates for d1ntoh2.
(The format of our PDB-style files is described here.)

Timeline for d1ntoh2: