Class b: All beta proteins [48724] (176 folds) |
Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) |
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
Protein Alcohol dehydrogenase [50137] (9 species) contains a Zn-finger subdomain, residues 94-117 |
Species Sulfolobus solfataricus [TaxId:2287] [82080] (4 PDB entries) |
Domain d1ntod1: 1nto D:1-143,D:314-347 [92143] Other proteins in same PDB: d1ntoa2, d1ntob2, d1ntoc2, d1ntod2, d1ntoe2, d1ntoh2 complexed with zn; mutant |
PDB Entry: 1nto (more details), 1.94 Å
SCOPe Domain Sequences for d1ntod1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntod1 b.35.1.2 (D:1-143,D:314-347) Alcohol dehydrogenase {Sulfolobus solfataricus [TaxId: 2287]} mravrlveigkplslqeigvpkpkgpqvlikveaagvchsdvhmrqgrfgnlrivedlgv klpvtlgheiagkieevgdevvgyskgdlvavnpwqgegncyycrigeehlcdsprwlgi nfdgayaeyvivphykymyklrrXvkpmitktmkleeaneaidnlenfkaigrqvlip
Timeline for d1ntod1: