SCOP 1.67: Domain d1ntkk_: 1ntk K:

Lineage for d1ntkk_ (1ntk K:)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family)

5. Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (1 protein)

6. Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species)
   the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located

7. Species Cow (Bos taurus) [TaxId:9913] [81515] (9 PDB entries)

8. Domain d1ntkk_: 1ntk K: [92120]
   Other proteins in same PDB: d1ntka1, d1ntka2, d1ntkb1, d1ntkb2, d1ntkc1, d1ntkc2, d1ntkd1, d1ntkd2, d1ntke1, d1ntke2, d1ntkf_, d1ntkg_, d1ntkh_, d1ntki_, d1ntkj_
   complexed with ay1, fes, hem

Details for d1ntkk_

PDB Entry: 1ntk, 2.6 Å

PDB Description: crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1

SCOP Domain Sequences for d1ntkk_:

Sequence; same for both SEQRES and ATOM records:

>d1ntkk_ f.23.15.1 (K:) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
mltrflgpryrqlarnwvptaqlwgavgavglvwatdwrlildwvpyingkfk

Timeline for d1ntkk_:

• d1ntkk_ is new in SCOP 1.67
  
• d1ntkk_ appears in SCOP 1.69
  
• d1ntkk_ appears in the current release, SCOPe 2.08