Lineage for d1ntkk_ (1ntk K:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026085Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) (S)
    automatically mapped to Pfam PF08997
  5. 3026086Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (2 proteins)
  6. 3026087Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species)
    the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located
  7. 3026088Species Cow (Bos taurus) [TaxId:9913] [81515] (12 PDB entries)
    Uniprot P07552
  8. 3026095Domain d1ntkk_: 1ntk K: [92120]
    Other proteins in same PDB: d1ntka1, d1ntka2, d1ntkb1, d1ntkb2, d1ntkc1, d1ntkc2, d1ntkd1, d1ntkd2, d1ntke1, d1ntke2, d1ntkf_, d1ntkg_, d1ntkh_, d1ntki_, d1ntkj_
    complexed with ay1, fes, hem

Details for d1ntkk_

PDB Entry: 1ntk (more details), 2.6 Å

PDB Description: crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
PDB Compounds: (K:) Ubiquinol-cytochrome c reductase complex 6.4 kDa protein

SCOPe Domain Sequences for d1ntkk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntkk_ f.23.15.1 (K:) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
mltrflgpryrqlarnwvptaqlwgavgavglvwatdwrlildwvpyingkfk

SCOPe Domain Coordinates for d1ntkk_:

Click to download the PDB-style file with coordinates for d1ntkk_.
(The format of our PDB-style files is described here.)

Timeline for d1ntkk_: