Details for d1ntkd2

PDB Entry: 1ntk (more details), 2.6 Å

PDB Description: crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1

SCOP Domain Sequences for d1ntkd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntkd2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus)}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

SCOP Domain Coordinates for d1ntkd2:

Click to download the PDB-style file with coordinates for d1ntkd2.
(The format of our PDB-style files is described here.)

Timeline for d1ntkd2: