Lineage for d1ndjb_ (1ndj B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2805820Protein Streptavidin [50878] (1 species)
  7. 2805821Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)
  8. 2806102Domain d1ndjb_: 1ndj B: [91819]
    complexed with btn; mutant

Details for d1ndjb_

PDB Entry: 1ndj (more details), 1.81 Å

PDB Description: streptavidin mutant y43f with biotin at 1.81a resolution
PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d1ndjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndjb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtfesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk

SCOPe Domain Coordinates for d1ndjb_:

Click to download the PDB-style file with coordinates for d1ndjb_.
(The format of our PDB-style files is described here.)

Timeline for d1ndjb_: