Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.2: Cytidylyltransferase [52394] (2 proteins) automatically mapped to Pfam PF01467 |
Protein CTP:glycerol-3-phosphate cytidylyltransferase [52395] (1 species) |
Species Bacillus subtilis [TaxId:1423] [52396] (2 PDB entries) |
Domain d1n1da_: 1n1d A: [91538] complexed with c2g, so4 |
PDB Entry: 1n1d (more details), 2 Å
SCOPe Domain Sequences for d1n1da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n1da_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]} mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt kikeei
Timeline for d1n1da_: