Lineage for d1n1dc_ (1n1d C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2468622Family c.26.1.2: Cytidylyltransferase [52394] (2 proteins)
    automatically mapped to Pfam PF01467
  6. 2468623Protein CTP:glycerol-3-phosphate cytidylyltransferase [52395] (1 species)
  7. 2468624Species Bacillus subtilis [TaxId:1423] [52396] (2 PDB entries)
  8. 2468629Domain d1n1dc_: 1n1d C: [91540]
    complexed with c2g, so4

Details for d1n1dc_

PDB Entry: 1n1d (more details), 2 Å

PDB Description: Glycerol-3-phosphate cytidylyltransferase complexed with CDP-glycerol
PDB Compounds: (C:) glycerol-3-phosphate cytidylyltransferase

SCOPe Domain Sequences for d1n1dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1dc_ c.26.1.2 (C:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]}
mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
kikeei

SCOPe Domain Coordinates for d1n1dc_:

Click to download the PDB-style file with coordinates for d1n1dc_.
(The format of our PDB-style files is described here.)

Timeline for d1n1dc_: