![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) ![]() |
![]() | Family c.26.1.2: Cytidylyltransferase [52394] (1 protein) |
![]() | Protein CTP:glycerol-3-phosphate cytidylyltransferase [52395] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [52396] (2 PDB entries) |
![]() | Domain d1n1da_: 1n1d A: [91538] |
PDB Entry: 1n1d (more details), 2 Å
SCOP Domain Sequences for d1n1da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n1da_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis} mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt kikeei
Timeline for d1n1da_: