Lineage for d1m8ua1 (1m8u A:1-85)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045692Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2045693Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2045694Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2045732Protein gamma-Crystallin [49697] (9 species)
    duplication consists of two domains of this fold
  7. 2045733Species Cow (Bos taurus), isoform E [TaxId:9913] [101571] (1 PDB entry)
  8. 2045734Domain d1m8ua1: 1m8u A:1-85 [91233]

Details for d1m8ua1

PDB Entry: 1m8u (more details), 1.65 Å

PDB Description: Crystal Structure of Bovine gamma-E at 1.65 Ang Resolution
PDB Compounds: (A:) gamma-E

SCOPe Domain Sequences for d1m8ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8ua1 b.11.1.1 (A:1-85) gamma-Crystallin {Cow (Bos taurus), isoform E [TaxId: 9913]}
gkitfyedrgfqgrhyecssdhsnlqpyfsrcnsirvdsgcwmiyeqpnfqgpqyflrrg
dypdyqqwmglndsirscrliphts

SCOPe Domain Coordinates for d1m8ua1:

Click to download the PDB-style file with coordinates for d1m8ua1.
(The format of our PDB-style files is described here.)

Timeline for d1m8ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m8ua2