PDB entry 1m8u

View 1m8u on RCSB PDB site
Description: Crystal Structure of Bovine gamma-E at 1.65 Ang Resolution
Class: structural protein
Keywords: gamma-crystallin, gamma-E, crystal structure, STRUCTURAL PROTEIN
Deposited on 2002-07-26, released 2003-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.186
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gamma-E
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23005 (0-172)
  Domains in SCOPe 2.06: d1m8ua1, d1m8ua2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m8uA (A:)
  gkitfyedrgfqgrhyecssdhsnlqpyfsrcnsirvdsgcwmiyeqpnfqgpqyflrrg
  dypdyqqwmglndsirscrliphtsshrlriyeredyrgqmveitedcsslherfhfsei
  hsfhvlegwwvlyempnyrgrqyllrpgdyrryhewgavdarvgslrravdfy