Lineage for d1ksqa1 (1ksq A:3-75)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2261347Fold g.23: TB module/8-cys domain [57580] (1 superfamily)
    disulfide-rich; alpha+beta
  4. 2261348Superfamily g.23.1: TB module/8-cys domain [57581] (1 family) (S)
  5. 2261349Family g.23.1.1: TB module/8-cys domain [57582] (2 proteins)
    transforming growth factor beta binding protein-like domain
  6. 2261359Protein Transforming growth factor-beta binding protein-1 [103586] (1 species)
  7. 2261360Species Human (Homo sapiens) [TaxId:9606] [103587] (1 PDB entry)
  8. 2261361Domain d1ksqa1: 1ksq A:3-75 [91026]
    Other proteins in same PDB: d1ksqa2
    third TB domain

Details for d1ksqa1

PDB Entry: 1ksq (more details)

PDB Description: nmr study of the third tb domain from latent transforming growth factor-beta binding protein-1
PDB Compounds: (A:) latent transforming growth factor beta binding protein 1

SCOPe Domain Sequences for d1ksqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksqa1 g.23.1.1 (A:3-75) Transforming growth factor-beta binding protein-1 {Human (Homo sapiens) [TaxId: 9606]}
dqpkeekkecyynlndaslcdnvlapnvtkqeccctsgagwgdnceifpcpvlgtaefte
mcpkgkgfvpage

SCOPe Domain Coordinates for d1ksqa1:

Click to download the PDB-style file with coordinates for d1ksqa1.
(The format of our PDB-style files is described here.)

Timeline for d1ksqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ksqa2