Lineage for d1ksqa_ (1ksq A:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 429461Fold g.23: TB module/8-cys domain [57580] (1 superfamily)
    disulfide-rich; alpha+beta
  4. 429462Superfamily g.23.1: TB module/8-cys domain [57581] (1 family) (S)
  5. 429463Family g.23.1.1: TB module/8-cys domain [57582] (2 proteins)
    transforming growth factor beta binding protein-like domain
  6. 429472Protein Transforming growth factor-beta binding protein-1 [103586] (1 species)
  7. 429473Species Human (Homo sapiens) [TaxId:9606] [103587] (1 PDB entry)
  8. 429474Domain d1ksqa_: 1ksq A: [91026]
    third TB domain

Details for d1ksqa_

PDB Entry: 1ksq (more details)

PDB Description: nmr study of the third tb domain from latent transforming growth factor-beta binding protein-1

SCOP Domain Sequences for d1ksqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksqa_ g.23.1.1 (A:) Transforming growth factor-beta binding protein-1 {Human (Homo sapiens)}
sadqpkeekkecyynlndaslcdnvlapnvtkqeccctsgagwgdnceifpcpvlgtaef
temcpkgkgfvpage

SCOP Domain Coordinates for d1ksqa_:

Click to download the PDB-style file with coordinates for d1ksqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ksqa_: