Class b: All beta proteins [48724] (176 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) the barrel is decorated with additional structures |
Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins) barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel |
Protein Diaminopimelate decarboxylase LysA [89350] (3 species) |
Species Escherichia coli [TaxId:562] [101820] (2 PDB entries) |
Domain d1ko0a1: 1ko0 A:2-31,A:279-420 [90971] Other proteins in same PDB: d1ko0a2 complexed with lys, plp |
PDB Entry: 1ko0 (more details), 2.2 Å
SCOPe Domain Sequences for d1ko0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ko0a1 b.49.2.3 (A:2-31,A:279-420) Diaminopimelate decarboxylase LysA {Escherichia coli [TaxId: 562]} phslfstdtdltaenllrlpaefgcpvwvyXvlitqvrsvkqmgsrhfvlvdagfndlmr pamygsyhhisalaadgrslehaptvetvvagplcesgdvftqqeggnvetralpevkag dylvlhdtgaygasmssnynsrpllpevlfdngqarlirrrqtieellalell
Timeline for d1ko0a1: