SCOPe 2.05: Domain d1ex0a4: 1ex0 A:191-510

Lineage for d1ex0a4 (1ex0 A:191-510)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.4: Transglutaminase core [54044] (3 proteins)

6. Protein Transglutaminase catalytic domain [54045] (4 species)

7. Species Human (Homo sapiens), blood isozyme [TaxId:9606] [54046] (8 PDB entries)
   Coagulation factor XIII

8. Domain d1ex0a4: 1ex0 A:191-510 [90468]
   Other proteins in same PDB: d1ex0a1, d1ex0a2, d1ex0a3, d1ex0b1, d1ex0b2, d1ex0b3
   complexed with ca, pgo, po4; mutant

Details for d1ex0a4

PDB Entry: 1ex0, 2 Å

PDB Description: human factor xiii, mutant w279f zymogen

PDB Compounds: (A:) coagulation factor xiii a chain

SCOPe Domain Sequences for d1ex0a4:

Sequence; same for both SEQRES and ATOM records:

>d1ex0a4 d.3.1.4 (A:191-510) Transglutaminase catalytic domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls
grgnpikvsrvgsamvnakddegvlvgsfdniyaygvppsawtgsvdilleyrssenpvr
ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw
nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf
vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee
rlaletalmygakkplntsr

Timeline for d1ex0a4:

• d1ex0a4 first appeared in SCOP 1.67
  
• d1ex0a4 appears in SCOPe 2.04
  
• d1ex0a4 appears in SCOPe 2.06
  
• d1ex0a4 appears in the current release, SCOPe 2.08