Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein) |
Protein Transglutaminase N-terminal domain [49235] (4 species) elaborated with many loop insertions in the common fold |
Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49236] (8 PDB entries) Coagulation factor XIII |
Domain d1ex0a1: 1ex0 A:7-190 [90465] Other proteins in same PDB: d1ex0a2, d1ex0a3, d1ex0a4, d1ex0b2, d1ex0b3, d1ex0b4 complexed with ca, pgo, po4; mutant |
PDB Entry: 1ex0 (more details), 2 Å
SCOPe Domain Sequences for d1ex0a1:
Sequence, based on SEQRES records: (download)
>d1ex0a1 b.1.18.9 (A:7-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]} afggrravppnnsnaaeddlptvelqgvnlrgvnlqeflnvtsvhlfkerwdtnkvdhht dkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselq sgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnp wced
>d1ex0a1 b.1.18.9 (A:7-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]} afggrravppnnsnaaeddlptveqeflnvtsvhlfkerwdtnkvdhhtdkyennklivr rgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgakivmr edrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwced
Timeline for d1ex0a1:
View in 3D Domains from other chains: (mouse over for more information) d1ex0b1, d1ex0b2, d1ex0b3, d1ex0b4 |