| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
| Species Human (Homo sapiens), HLA-B35 [TaxId:9606] [54475] (16 PDB entries) Uniprot P30685 25-300 |
| Domain d1cg9a2: 1cg9 A:1-181 [90420] Other proteins in same PDB: d1cg9a1, d1cg9b1, d1cg9b2 |
PDB Entry: 1cg9 (more details), 2.7 Å
SCOPe Domain Sequences for d1cg9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cg9a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B35 [TaxId: 9606]}
gshsmryfytamfrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r
Timeline for d1cg9a2: