SCOP 1.65: Domain d1pn8l_: 1pn8 L:

Lineage for d1pn8l_ (1pn8 L:)

1. Root: SCOP 1.65

2. Class i: Low resolution protein structures [58117] (18 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (2 species)

7. Species Escherichia coli [TaxId:562] [58123] (21 PDB entries)

8. Domain d1pn8l_: 1pn8 L: [88166]

Details for d1pn8l_

PDB Entry: 1pn8

PDB Description: coordinates of s12, l11 proteins and e-site trna from 70s crystal structure separately fitted into the cryo-em map of e.coli 70s.ef-g.gdpnp complex. the atomic coordinates originally from the e-site trna were fitted in the position of the hybrid p/e-site trna.

SCOP Domain Sequences for d1pn8l_:

Sequence; same for both SEQRES and ATOM records:

>d1pn8l_ i.1.1.1 (L:) 70S ribosome functional complex {Escherichia coli}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

Timeline for d1pn8l_:

• d1pn8l_ is new in SCOP 1.65
  
• d1pn8l_ appears in SCOP 1.67
  
• d1pn8l_ appears in the current release, SCOPe 2.08