PDB entry 1pn8

View 1pn8 on RCSB PDB site
Description: coordinates of s12, l11 proteins and e-site trna from 70s crystal structure separately fitted into the cryo-em map of e.coli 70s.ef-g.gdpnp complex. the atomic coordinates originally from the e-site trna were fitted in the position of the hybrid p/e-site trna.
Deposited on 2003-06-12, released 2003-07-15
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-15, with a file datestamp of 2003-07-15.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Domains in SCOP 1.65: d1pn8d_
  • Chain 'L':
    Domains in SCOP 1.65: d1pn8l_
  • Chain 'O':
    Domains in SCOP 1.65: d1pn8o_

PDB Chain Sequences:

  • Chain 'D':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pn8L (L:)
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pn8O (O:)
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea