Class a: All alpha proteins [46456] (286 folds) |
Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) automatically mapped to Pfam PF01466 |
Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins) |
Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [81376] (9 PDB entries) |
Domain d1p22b1: 1p22 B:64-136 [87717] Other proteins in same PDB: d1p22a1, d1p22a2, d1p22b2 |
PDB Entry: 1p22 (more details), 2.95 Å
SCOPe Domain Sequences for d1p22b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p22b1 a.157.1.1 (B:64-136) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd fteeeeaqvrken
Timeline for d1p22b1: