Lineage for d1p22a1 (1p22 A:135-252)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752306Fold a.158: F-box domain [81385] (1 superfamily)
    multihelical; interlocked heterodimer with the Skp1 dimerisation domain
  4. 1752307Superfamily a.158.1: F-box domain [81383] (1 family) (S)
  5. 1752308Family a.158.1.1: F-box domain [81381] (4 proteins)
  6. 1752320Protein F-box/WD-repeat protein 1 (beta-TRCP1) [89138] (1 species)
  7. 1752321Species Human (Homo sapiens) [TaxId:9606] [89139] (1 PDB entry)
  8. 1752322Domain d1p22a1: 1p22 A:135-252 [87715]
    Other proteins in same PDB: d1p22a2, d1p22b1, d1p22b2

Details for d1p22a1

PDB Entry: 1p22 (more details), 2.95 Å

PDB Description: Structure of a beta-TrCP1-Skp1-beta-catenin complex: destruction motif binding and lysine specificity on the SCFbeta-TrCP1 ubiquitin ligase
PDB Compounds: (A:) F-box/WD-repeat protein 1A

SCOPe Domain Sequences for d1p22a1:

Sequence, based on SEQRES records: (download)

>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}
spaimlqrdfitalpargldhiaenilsyldakslcaaelvckewyrvtsdgmlwkklie
rmvrtdslwrglaerrgwgqylfknkppdgnappnsfyralypkiiqdietiesnwrc

Sequence, based on observed residues (ATOM records): (download)

>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}
spaimlqrdfitalpargldhiaenilsyldakslcaaelvckewyrvtsdgmlwkklie
rmvrtdslwrglaerrgwgqylfppnsfyralypkiiqdietiesnwrc

SCOPe Domain Coordinates for d1p22a1:

Click to download the PDB-style file with coordinates for d1p22a1.
(The format of our PDB-style files is described here.)

Timeline for d1p22a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p22a2