Lineage for d1oyea5 (1oye A:182-273)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613704Fold d.225: Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains [82713] (1 superfamily)
    Intertwined pseudo hexamer of an alpha+beta motif
  4. 2613705Superfamily d.225.1: Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains [82714] (1 family) (S)
    duplication: the N- and C-terminal halves of the whole proteins are structurally similar
  5. 2613706Family d.225.1.1: Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains [82715] (1 protein)
  6. 2613707Protein Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains [82716] (1 species)
  7. 2613708Species Escherichia coli [TaxId:562] [82717] (7 PDB entries)
  8. 2613719Domain d1oyea5: 1oye A:182-273 [87591]
    Other proteins in same PDB: d1oyea1, d1oyea2, d1oyea3, d1oyea4, d1oyea7, d1oyea8
    complexed with cpf

Details for d1oyea5

PDB Entry: 1oye (more details), 3.48 Å

PDB Description: Structural Basis of Multiple Binding Capacity of the AcrB multidrug Efflux Pump
PDB Compounds: (A:) Acriflavine resistance protein B

SCOPe Domain Sequences for d1oyea5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oyea5 d.225.1.1 (A:182-273) Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains {Escherichia coli [TaxId: 562]}
yamriwmnpnelnkfqltpvdvitaikaqnaqvaagqlggtppvkgqqlnasiiaqtrlt
steefgkillkvnqdgsrvllrdvakielgge

SCOPe Domain Coordinates for d1oyea5:

Click to download the PDB-style file with coordinates for d1oyea5.
(The format of our PDB-style files is described here.)

Timeline for d1oyea5: