Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.225: Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains [82713] (1 superfamily) Intertwined pseudo hexamer of an alpha+beta motif |
Superfamily d.225.1: Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains [82714] (1 family) duplication: the N- and C-terminal halves of the whole proteins are structurally similar |
Family d.225.1.1: Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains [82715] (1 protein) |
Protein Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains [82716] (1 species) |
Species Escherichia coli [TaxId:562] [82717] (7 PDB entries) |
Domain d1oyea5: 1oye A:182-273 [87591] Other proteins in same PDB: d1oyea1, d1oyea2, d1oyea3, d1oyea4, d1oyea7, d1oyea8 complexed with cpf |
PDB Entry: 1oye (more details), 3.48 Å
SCOPe Domain Sequences for d1oyea5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oyea5 d.225.1.1 (A:182-273) Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains {Escherichia coli [TaxId: 562]} yamriwmnpnelnkfqltpvdvitaikaqnaqvaagqlggtppvkgqqlnasiiaqtrlt steefgkillkvnqdgsrvllrdvakielgge
Timeline for d1oyea5: