SCOPe 2.07: Domain d1oyea1: 1oye A:38-134

Lineage for d1oyea1 (1oye A:38-134)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.44: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82693] (1 family)
   duplication: the N- and C-terminal halves of the whole proteins are structurally similar; each half contains two domains of this fold

5. Family d.58.44.1: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82694] (1 protein)

6. Protein Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82695] (1 species)
   PN2 and PC2 subdomains are interrupted by the inserted subdomains DN and DC, respectively

7. Species Escherichia coli [TaxId:562] [82696] (7 PDB entries)

8. Domain d1oyea1: 1oye A:38-134 [87587]
   Other proteins in same PDB: d1oyea5, d1oyea6, d1oyea7, d1oyea8
   complexed with cpf

Details for d1oyea1

PDB Entry: 1oye, 3.48 Å

PDB Description: Structural Basis of Multiple Binding Capacity of the AcrB multidrug Efflux Pump

PDB Compounds: (A:) Acriflavine resistance protein B

SCOPe Domain Sequences for d1oyea1:

Sequence; same for both SEQRES and ATOM records:

>d1oyea1 d.58.44.1 (A:38-134) Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains {Escherichia coli [TaxId: 562]}
iappavtisasypgadaktvqdtvtqvieqnmngidnlmymssnsdstgtvqitltfesg
tdadiaqvqvqnklqlampllpqevqqqgvsveksss

Timeline for d1oyea1:

• d1oyea1 first appeared in SCOP 1.65
  
• d1oyea1 appears in SCOPe 2.06
  
• d1oyea1 appears in the current release, SCOPe 2.08