Lineage for d1oo0a_ (1oo0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008314Fold d.232: Mago nashi protein [89816] (1 superfamily)
    beta(4)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, order: 651234
  4. 3008315Superfamily d.232.1: Mago nashi protein [89817] (1 family) (S)
    automatically mapped to Pfam PF02792
  5. 3008316Family d.232.1.1: Mago nashi protein [89818] (2 proteins)
  6. 3008317Protein Mago nashi protein [89819] (2 species)
  7. 3008318Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89820] (3 PDB entries)
  8. 3008319Domain d1oo0a_: 1oo0 A: [87182]
    Other proteins in same PDB: d1oo0b_
    protein/RNA complex; complexed with bme, gol, mpd, sr

Details for d1oo0a_

PDB Entry: 1oo0 (more details), 1.85 Å

PDB Description: Crystal structure of the Drosophila Mago nashi-Y14 complex
PDB Compounds: (A:) mago nashi protein

SCOPe Domain Sequences for d1oo0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oo0a_ d.232.1.1 (A:) Mago nashi protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
edfylryyvghkgkfgheflefefrpdgklryannsnykndtmirkeafvhqsvmeelkr
iiidseimqeddlpwpppdrvgrqeleivigdehisfttsktgslvdvnrskdpeglrcf
yylvqdlkclvfsliglhfkikpi

SCOPe Domain Coordinates for d1oo0a_:

Click to download the PDB-style file with coordinates for d1oo0a_.
(The format of our PDB-style files is described here.)

Timeline for d1oo0a_: