PDB entry 1oo0

View 1oo0 on RCSB PDB site
Description: Crystal structure of the Drosophila Mago nashi-Y14 complex
Class: signaling protein
Keywords: RNA recognition motif, splicing, Protein complex, Exon junction complex, SIGNALING PROTEIN
Deposited on 2003-03-02, released 2003-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.215
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mago nashi protein
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: MAGO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oo0a_
  • Chain 'B':
    Compound: cg8781-pa
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: TSU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oo0b_
  • Heterogens: SR, BME, MPD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oo0A (A:)
    mstedfylryyvghkgkfgheflefefrpdgklryannsnykndtmirkeafvhqsvmee
    lkriiidseimqeddlpwpppdrvgrqeleivigdehisfttsktgslvdvnrskdpegl
    rcfyylvqdlkclvfsliglhfkikpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oo0A (A:)
    edfylryyvghkgkfgheflefefrpdgklryannsnykndtmirkeafvhqsvmeelkr
    iiidseimqeddlpwpppdrvgrqeleivigdehisfttsktgslvdvnrskdpeglrcf
    yylvqdlkclvfsliglhfkikpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oo0B (B:)
    aihsyervrnedddelepgpqrsvegwilfvtsiheeaqedeiqekfcdygeiknihlnl
    drrtgfskgyalveyethkqalaakealngaeimgqtiqvdwcfvkgpkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oo0B (B:)
    pgpqrsvegwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyet
    hkqalaakealngaeimgqtiqvdwcfvkgpk